CLD2_MOUSE O88552
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88552
Recommended name：Claudin-2
EC number：
Alternative names：
Cleaved into：
GeneID：12738
Gene names (primary )：Cldn2
Gene names (synonym )：
Gene names (ORF )：
Length：230
Mass：24484
Sequence：MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV
Tissue specificity：Expressed in the kidney, liver and intestine, with higher levels in the ileum than in the jejunum. Low levels in the brain. {ECO:0000269|PubMed:11934881, ECO:0000269|PubMed:9647647}.
Induction：By CDX1 and CDX2. Induction by CDX2, but not CDX1, is potentiated by TCF1. {ECO:0000269|PubMed:11934881}.
Developmental stage：
Protein families：Claudin family