C42S2_HUMAN Q9NRR3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NRR3
Recommended name：CDC42 small effector protein 2
EC number：
Alternative names：(Small effector of CDC42 protein 2)
Cleaved into：
GeneID：56990
Gene names (primary )：CDC42SE2
Gene names (synonym )：SPEC2
Gene names (ORF )：
Length：84
Mass：9223
Sequence：MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
Tissue specificity：Widely expressed. Expressed at higher level in T-lymphocytes. Highly expressed in CCRF-CEM T-lymphocytes, Jurkat T-lymphocytes, and Raji B-lymphocytes compared (at protein level). {ECO:0000269|PubMed:15840583}.
Induction：
Developmental stage：
Protein families：CDC42SE/SPEC family