SR1IP_HUMAN Q8N9Q2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N9Q2
Recommended name：Protein SREK1IP1
EC number：
Alternative names：(SFRS12-interacting protein 1) (SREK1-interacting protein 1) (Splicing regulatory protein of 18 kDa) (p18SRP)
Cleaved into：
GeneID：285672
Gene names (primary )：SREK1IP1
Gene names (synonym )：P18SRP SFRS12IP1
Gene names (ORF )：
Length：155
Mass：18177
Sequence：MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRINEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKKEKHSSTPNSSEFSRK
Tissue specificity：
Induction：Down-regulated in the brains of Alzheimer disease patients. {ECO:0000269|PubMed:15456940}.
Developmental stage：
Protein families：