NDKM_HUMAN O00746
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O00746
Recommended name：Nucleoside diphosphate kinase, mitochondrial
EC number：EC:2.7.4.6
Alternative names：(NDK) (NDP kinase, mitochondrial) (Nucleoside diphosphate kinase D) (NDPKD) (nm23-H4)
Cleaved into：
GeneID：4833
Gene names (primary )：NME4
Gene names (synonym )：NM23D
Gene names (ORF )：
Length：187
Mass：20659
Sequence：MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Tissue specificity：Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
Induction：
Developmental stage：
Protein families：NDK family