RAB8B_RAT P70550
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70550
Recommended name：Ras-related protein Rab-8B
EC number：EC:3.6.5.2
Alternative names：
Cleaved into：
GeneID：266688
Gene names (primary )：Rab8b
Gene names (synonym )：
Gene names (ORF )：
Length：
Mass：23,603
Sequence：MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL
Tissue specificity：Hight levels of expression in the spleen, heart, kidney, testis and brain. Expression increases in Sertoli and germ cells during their maturation. 1
Induction：
Developmental stage：Localizes in the basal compartment associating with spermatocytes in all stages of the spermatogenic cycle. Detected at the site of elongate spermatids in stages XII-XIV in addition to being found in the basal compartment in these stages. 1
Protein families：