RAP2C_HUMAN Q9Y3L5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y3L5
Recommended name:Ras-related protein Rap-2c
EC number:EC:3.6.5.2
Alternative names:
Cleaved into:
GeneID:57826
Gene names (primary ):RAP2C
Gene names (synonym ):
Gene names (ORF ):
Length:183
Mass:20745
Sequence:MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ
Tissue specificity:Expressed in liver, skeletal muscle, prostate, uterus, rectum, stomach, and bladder and to a lower extent in brain, kidney, pancreas, and bone marrow. Expressed in mononuclear leukocytes and megakaryocytes. {ECO:0000269|PubMed:16213650, ECO:0000269|PubMed:17447155}.
Induction:
Developmental stage:
Protein families:Small GTPase superfamily, Ras family