ZDH15_HUMAN   Q96MV8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96MV8

Recommended name:Palmitoyltransferase ZDHHC15

EC number:EC:2.3.1.225

Alternative names:(Acyltransferase ZDHHC15) (Zinc finger DHHC domain-containing protein 15) (DHHC-15)

Cleaved into:

GeneID:158866

Gene names  (primary ):ZDHHC15

Gene names  (synonym ):

Gene names  (ORF ):UNQ1969/PRO4501

Length:337

Mass:39331

Sequence:MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET

Tissue specificity:Expressed in placenta, liver, lung, kidney, heart and brain. {ECO:0000269|PubMed:15915161}.

Induction:

Developmental stage:

Protein families:DHHC palmitoyltransferase family


   💬 WhatsApp