MC5R_RAT P35345
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35345
Recommended name：Melanocortin receptor 5
EC number：
Alternative names：
Cleaved into：
GeneID：25726
Gene names (primary )：Mc5r
Gene names (synonym )：
Gene names (ORF )：
Length：325
Mass：37,050
Sequence：MNSSSHLTLLDLTLNASEDNILGQNVNNKSSACEDMGIAVEVFLTLGLVSLLENILVIGAIVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETITIYLINNKHVVIADTFVRHIDNVFDSMICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIYYESKYVIVCLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRASMKGAITLTMLLGIFIVCWSPFFLHLILMISCPQNVYCACFMSYFNMYLILIMCNSVIDPLIYALRSQEMRRTFKEIICCHGFRRTCTLLGRY
Tissue specificity：Very low expression levels is detected in brain, while high levels are found in adrenals, stomach, lung and spleen.
Induction：
Developmental stage：
Protein families：