1433G_HUMAN P61981
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61981
Recommended name：14-3-3 protein gamma
EC number：
Alternative names：(Protein kinase C inhibitor protein 1) (KCIP-1)
Cleaved into：14-3-3 protein gamma, N-terminally processed
GeneID：7532
Gene names (primary )：YWHAG
Gene names (synonym )：
Gene names (ORF )：
Length：247
Mass：28303
Sequence：MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
Tissue specificity：Highly expressed in brain, skeletal muscle, and heart. {ECO:0000269|PubMed:10486217}.
Induction：
Developmental stage：
Protein families：14-3-3 family