EMC9_MOUSE   Q9DB76


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DB76

Recommended name:ER membrane protein complex subunit 9

EC number:

Alternative names:(Protein FAM158A)

Cleaved into:

GeneID:85308

Gene names  (primary ):Emc9

Gene names  (synonym ):Cgi112 Fam158a

Gene names  (ORF ):

Length:206

Mass:22787

Sequence:MGEVEISARAYGKMCLHASRYPHAAVNGLLLAPATGSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAVLDDQSPGPLALKIAGRIAEFFPRAVLIMLDNKKLVTRPRVPPVIVLENQGLQWVPKDKNLVMWRDWEESRQMVGALLEGRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWSGSTDGNA

Tissue specificity:

Induction:

Developmental stage:

Protein families:EMC8/EMC9 family


   💬 WhatsApp