WDFY2_MOUSE Q8BUB4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BUB4
Recommended name：WD repeat and FYVE domain-containing protein 2
EC number：
Alternative names：(Propeller-FYVE protein) (Prof) (WD40- and FYVE domain-containing protein 2)
Cleaved into：
GeneID：268752
Gene names (primary )：Wdfy2
Gene names (synonym )：
Gene names (ORF )：
Length：400
Mass：45094
Sequence：MAAEIQPQPLTRKPILLQRVEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSIYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMVLFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLLTSFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDKVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Tissue specificity：Highly expressed in the brain (at protein level). {ECO:0000269|PubMed:16792529}.
Induction：Transiently up-regulated during adipogenesis (at protein level). {ECO:0000269|PubMed:18388859}.
Developmental stage：
Protein families：