GUC1B_MOUSE   Q8VBV8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VBV8

Recommended name:Guanylyl cyclase-activating protein 2

EC number:

Alternative names:(GCAP 2) (Guanylate cyclase activator 1B)

Cleaved into:

GeneID:107477

Gene names  (primary ):Guca1b

Gene names  (synonym ):

Gene names  (ORF ):

Length:201

Mass:23520

Sequence:MGQQLSWEEAEAAGEMDVAELQEWYKKFVVECPSGTLFMHEFKRFFKVTGNEEASQYVESMFRAFDKNGDNTIDFLEYVAALNLVLRGSLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKLKKACRAELDLEHQGQLLTPEEVVDRIFLLVDENGDGQLSLTEFIEGARRDKWVMKMLQMDINPGCWITQQRRRSAMF

Tissue specificity:Expressed in rod photoreceptors in the retina (at protein level). Expressed in cone photoreceptor cells (PubMed:9620085). {ECO:0000269|PubMed:15961391, ECO:0000269|PubMed:9620085}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp