FUT1_MOUSE O09160
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O09160
Recommended name：Galactoside alpha-(1,2)-fucosyltransferase 1
EC number：
Alternative names：(Alpha(1,2)FT 1) (Fucosyltransferase 1) (MFUT-1) (GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1) (Type 1 galactoside alpha-(1,2)-fucosyltransferase FUT1) (Type 2 galactoside alpha-(1,2)-fucosyltransferase FUT1) (EC 2.4.1.344)
Cleaved into：
GeneID：14343
Gene names (primary )：Fut1
Gene names (synonym )：
Gene names (ORF )：
Length：377
Mass：42394
Sequence：MWTPSRRQLCLAFLLVCVLSAGSFFFHLNGGNFFRNGLTLSVLCSDYHLLKSPVAMVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLALAQLNGRQAFIQPEMHAALAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLREQIRREFTLHNHLREGAQYLLSGLRIGPAGIRPHTFVGVHVRRGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSNGMKWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV
Tissue specificity：In the adult, highly expressed in pancreas, testis and epididymis and to a lesser extent in thymus, lung, stomach, small intestine, colon, spleen and uterus. Not expressed in brain, heart, skeletal muscle, kidney, liver and bone marrow (PubMed:9355741). Expressed in epididymis and testis (PubMed:11368156). {ECO:0000269|PubMed:11368156, ECO:0000269|PubMed:9355741}.
Induction：
Developmental stage：
Protein families：Glycosyltransferase 11 family