VP26C_MOUSE O35075
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35075
Recommended name：Vacuolar protein sorting-associated protein 26C
EC number：
Alternative names：(Down syndrome critical region protein 3 homolog) (Down syndrome critical region protein A homolog)
Cleaved into：
GeneID：13185
Gene names (primary )：Vps26c
Gene names (synonym )：Dcra Dscr3 Dscra
Gene names (ORF )：
Length：297
Mass：32970
Sequence：MGTTLDIKIKRANKVYHAGEMLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSTIDVLKPGKIPSGKTEVPFEFPLLVKGSKVLYETYHGVFVNIQYTLRCDMRRSLLAKDLTKTCEFIVHSAPQKGKLTPSPVDFTITPETLQNVKERASLPKFFIRGHLNSTNCAITQPLTGELVVEHSDAAIRSIELQLVRVETCGCAEGYARDATEIQNIQIADGDICRNLSVPLYMVFPRLFTCPTLETTNFKVEFEVNVVVLLHADHLITENFPLKLCRT
Tissue specificity：
Induction：
Developmental stage：
Protein families：VPS26 family