PPCT_MOUSE P53808
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P53808
Recommended name：Phosphatidylcholine transfer protein
EC number：
Alternative names：(PC-TP) (START domain-containing protein 2) (StARD2) (StAR-related lipid transfer protein 2)
Cleaved into：
GeneID：
Gene names (primary )：Pctp
Gene names (synonym )：Stard2
Gene names (ORF )：
Length：214
Mass：24785
Sequence：MAGAACCFSDEQFREACAELQKPALTGADWQLLVEASGITIYRLLDQPSGLYEYKVFGVLEGCSPALLTDVYMDLDYRKQWDQYVKELYEKESDEQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDRRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNYHKKT
Tissue specificity：Abundant in liver of pups but levels in liver decrease 10-fold about 2 weeks after birth. In adult, highly expressed in epididymis, testis, kidney and bone-marrow derived mast cells. {ECO:0000269|PubMed:10500206}.
Induction：
Developmental stage：
Protein families：