CCR6_MOUSE O54689
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54689
Recommended name：C-C chemokine receptor type 6
EC number：
Alternative names：(C-C CKR-6) (CC-CKR-6) (CCR-6) (KY411) (CD antigen CD196)
Cleaved into：
GeneID：12458
Gene names (primary )：Ccr6
Gene names (synonym )：Cmkbr6
Gene names (ORF )：
Length：367
Mass：42103
Sequence：MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFMVFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCSTEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVENDNASSFTM
Tissue specificity：Sperm. Mainly localized in the principal piece and neck region of the tail but is also found in the acrosomal region in a small percentage of sperm cells. Expressed in natural regulatory T cells (nTregs) and a subset of early thymocyte progenitor double-negative 1 (DN1) cells. Expressed in memory B cells. Expressed by IL17 producing helper T-cells (Th17), type 1 effector cells (Th1), type 2 effector cells (Th2) and regulatory T-cells (Treg) (at protein level). Expressed by Th17 cells in spleen, Peyers patches, and lamina propria of small and large intestine. Highly expressed in testis, lung, colon, and dendritic cells. {ECO:0000269|PubMed:19050256, ECO:0000269|PubMed:19129757, ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:24638065, ECO:0000269|PubMed:25505290}.
Induction：Up-regulated on pre-germinal center B-cells in a CD40-dependent manner. Up-regulated and down-regulated in Th17 cells by TGFB1 and IL2 respectively. {ECO:0000269|PubMed:19050256, ECO:0000269|PubMed:19129757, ECO:0000269|PubMed:27174992}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family