UB2L6_HUMAN O14933
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14933
Recommended name：Ubiquitin/ISG15-conjugating enzyme E2 L6
EC number：EC:2.3.2.23
Alternative names：(E2 ubiquitin-conjugating enzyme L6) (Retinoic acid-induced gene B protein) (RIG-B) (UbcH8) (Ubiquitin carrier protein L6) (Ubiquitin-protein ligase L6)
Cleaved into：
GeneID：9246
Gene names (primary )：UBE2L6
Gene names (synonym )：UBCH8
Gene names (ORF )：
Length：153
Mass：17769
Sequence：MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Tissue specificity：Present in natural killer cells (at protein level). {ECO:0000269|PubMed:16709802}.
Induction：By IFNB1/IFN-beta. {ECO:0000269|PubMed:15131269}.
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family