TYB4_RAT P62329
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62329
Recommended name：Thymosin beta-4
EC number：
Alternative names：Hematopoietic system regulatory peptide Alternative names: Seraspenide
Cleaved into：
GeneID：81814
Gene names (primary )：Tmsb4x
Gene names (synonym )：Thyb4, Tmsb4
Gene names (ORF )：
Length：44
Mass：5,053
Sequence：MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Tissue specificity：Originally found in thymus but it is widely distributed in many tissues. 1
Induction：
Developmental stage：By NGF and fibroblast growth factors. 1
Protein families：