FCRL1_MOUSE Q8R4Y0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R4Y0
Recommended name：Fc receptor-like protein 1
EC number：
Alternative names：(FcR-like protein 1) (FcRL1) (BXMAS1-like protein 1) (mBXMH1) (Fc receptor homolog 1) (FcRH1) (moFcRH1) (IFGP family protein 1) (mIFGP1) (CD antigen CD307a)
Cleaved into：
GeneID：229499
Gene names (primary )：Fcrl1
Gene names (synonym )：Fcrh1 Ifgp1
Gene names (ORF )：
Length：343
Mass：37277
Sequence：MLPWLLLLICALPCEPAGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSLGLTGWLLGCLSPITMALIFCYWLKRKIGRQSEDPVRSPPQTVLQGSTYPKSPDSRQPEPLYENVNVVSGNEVYSLVYHTPQVLEPAAAQHVRTHGVSESFQVSSGLYSKPRINIAHMDYEDAM
Tissue specificity：Widely expressed. Expressed in B-cells at the various stages of differentiation. {ECO:0000269|PubMed:12037601, ECO:0000269|PubMed:15302849}.
Induction：
Developmental stage：
Protein families：