NKX62_HUMAN   Q9C056


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9C056

Recommended name:Homeobox protein Nkx-6.2

EC number:

Alternative names:(Homeobox protein NK-6 homolog B)

Cleaved into:

GeneID:84504

Gene names  (primary ):NKX6-2

Gene names  (synonym ):GTX NKX6B

Gene names  (ORF ):

Length:277

Mass:29263

Sequence:MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL

Tissue specificity:Highest expression in brain. {ECO:0000269|PubMed:11210186}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp