MAFA_MOUSE Q8CF90
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CF90
Recommended name：Transcription factor MafA
EC number：
Alternative names：(Pancreatic beta-cell-specific transcriptional activator) (V-maf musculoaponeurotic fibrosarcoma oncogene homolog A)
Cleaved into：
GeneID：378435
Gene names (primary )：Mafa
Gene names (synonym )：
Gene names (ORF )：
Length：359
Mass：37576
Sequence：MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCSSVPSSPSFCAPSPGTGGGAGGGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAAAAAYEAFRGQSFAGGGGADDMGAGHHHGAHHTAHHHHSAHHHHHHHHHHGGSGHHGGGAGHGGGGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAKGAPDFFL
Tissue specificity：Expressed in brain, lung, spleen, pancreas and kidney (PubMed:12368292, PubMed:14680841). In the pancreas, expressed in the insulin-producing beta-cells of the islets of Langerhans (at protein level) (PubMed:12917329, PubMed:15923615). Also expressed in the eye (PubMed:12368292, PubMed:15923615). {ECO:0000269|PubMed:12368292, ECO:0000269|PubMed:12917329, ECO:0000269|PubMed:14680841, ECO:0000269|PubMed:15923615}.
Induction：Up-regulated by glucose in pancreatic beta-cell lines. {ECO:0000269|PubMed:12368292}.
Developmental stage：In the developing pancreas, expressed exclusively in the insulin-positive cells from 13.5 dpc onward and never in the glucagon-expressing cells (at protein level) (PubMed:14973194). At 12.5dpc, at the mRNA level, detected in each formed somite, in myotomal cells. Also detected in the head neural tube, liver cells and, at low levels, in some mesenchyme-like cells (PubMed:14680841). {ECO:0000269|PubMed:14680841, ECO:0000269|PubMed:14973194}.
Protein families：BZIP family, Maf subfamily