RFL3S_HUMAN P0C7P2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C7P2
Recommended name：Putative protein RFPL3S
EC number：
Alternative names：(RFPL3 antisense RNA 1) (RFPL3 antisense gene protein 1) (Ret finger protein-like 3 antisense gene protein)
Cleaved into：
GeneID：
Gene names (primary )：RFPL3S
Gene names (synonym )：RFPL3-AS1
Gene names (ORF )：
Length：107
Mass：11739
Sequence：MQTDTSNLSARSCRFCVMSPLRTLLRSSEMRRKLLAVSASKVISTVKRKTSCSASGQKPTPCLSSTSKAQISPDFSFFNSVSSSKIKTFHEETSLFQIFIGMLCGNT
Tissue specificity：Strongly expressed in the testis and weakly in brain, placenta and pancreas. {ECO:0000269|PubMed:10508838}.
Induction：
Developmental stage：
Protein families：