NR2F6_HUMAN   P10588


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P10588

Recommended name:Nuclear receptor subfamily 2 group F member 6

EC number:

Alternative names:(V-erbA-related protein 2) (EAR-2)

Cleaved into:

GeneID:2063

Gene names  (primary ):NR2F6

Gene names  (synonym ):EAR2 ERBAL2

Gene names  (ORF ):

Length:404

Mass:42979

Sequence:MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

Tissue specificity:Expressed in heart, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:10713182}.

Induction:Inhibited by gonadotropin in granulosa cells. {ECO:0000269|PubMed:11682620}.

Developmental stage:

Protein families:Nuclear hormone receptor family, NR2 subfamily


   💬 WhatsApp