GPX4_HUMAN   P36969


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P36969

Recommended name:Phospholipid hydroperoxide glutathione peroxidase

EC number:EC:1.11.1.12

Alternative names:(PHGPx) (Glutathione peroxidase 4) (GPx-4) (GSHPx-4)

Cleaved into:

GeneID:2879

Gene names  (primary ):GPX4

Gene names  (synonym ):

Gene names  (ORF ):

Length:197

Mass:22175

Sequence:MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Tissue specificity:Present primarily in testis. Expressed in platelets (at protein level) (PubMed:11115402). {ECO:0000269|PubMed:11115402, ECO:0000269|PubMed:9705830}.

Induction:

Developmental stage:

Protein families:Glutathione peroxidase family


   💬 WhatsApp