RN182_MOUSE Q8C432
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C432
Recommended name:E3 ubiquitin-protein ligase RNF182
EC number:EC 2.3.2.27
Alternative names:(RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)
Cleaved into:
GeneID:328234
Gene names (primary ):Rnf182
Gene names (synonym ):
Gene names (ORF ):
Length:247
Mass:27444
Sequence:MASQPLEEPAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMALPS
Tissue specificity:Expressed in the cortex, hippocampus, cerebellum and spinal cord, but not in the heart, liver, kidney or skeletal muscle. {ECO:0000269|PubMed:18298843}.
Induction:
Developmental stage:
Protein families: