NHP2_HUMAN Q9NX24
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NX24
Recommended name：H/ACA ribonucleoprotein complex subunit 2
EC number：
Alternative names：(Nucleolar protein family A member 2) (snoRNP protein NHP2)
Cleaved into：
GeneID：55651
Gene names (primary )：NHP2
Gene names (synonym )：NOLA2
Gene names (ORF )：HSPC286
Length：153
Mass：17201
Sequence：MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
Tissue specificity：Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver. {ECO:0000269|PubMed:12020816}.
Induction：
Developmental stage：Transcript peaks at G1/S transition. {ECO:0000269|PubMed:12020816}.
Protein families：Eukaryotic ribosomal protein eL8 family