C1QT2_HUMAN   Q9BXJ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BXJ5

Recommended name:Complement C1q tumor necrosis factor-related protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:114898

Gene names  (primary ):C1QTNF2

Gene names  (synonym ):CTRP2

Gene names  (ORF ):UNQ6349/PRO21054

Length:285

Mass:29952

Sequence:MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV

Tissue specificity:Expressed in adipose tissue. {ECO:0000269|PubMed:31439668}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp