PPIL3_HUMAN   Q9H2H8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H2H8

Recommended name:Peptidyl-prolyl cis-trans isomerase-like 3

EC number:EC:5.2.1.8

Alternative names:(PPIase) (Cyclophilin J) (CyPJ) (Cyclophilin-like protein PPIL3) (Rotamase PPIL3)

Cleaved into:

GeneID:53938

Gene names  (primary ):PPIL3

Gene names  (synonym ):

Gene names  (ORF ):

Length:161

Mass:18155

Sequence:MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ

Tissue specificity:Ubiquitous. Detected at low levels. {ECO:0000269|PubMed:11435694}.

Induction:

Developmental stage:

Protein families:Cyclophilin-type PPIase family, PPIL3 subfamily


   💬 WhatsApp