PIPNA_HUMAN Q00169
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q00169
Recommended name：Phosphatidylinositol transfer protein alpha isoform
EC number：
Alternative names：(PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha)
Cleaved into：
GeneID：5306
Gene names (primary )：PITPNA
Gene names (synonym )：PITPN
Gene names (ORF )：
Length：270
Mass：31806
Sequence：MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Tissue specificity：Expressed in a wide range of tissues.
Induction：
Developmental stage：
Protein families：PtdIns transfer protein family, PI transfer class I subfamily