CSRP2_RAT Q62908
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62908
Recommended name：Cysteine and glycine-rich protein 2
EC number：
Alternative names：
Cleaved into：
GeneID：29317
Gene names (primary )：Csrp2
Gene names (synonym )：Smlim
Gene names (ORF )：
Length：193
Mass：20,940
Sequence：MPVWGGGNKCGACGRTVYHAEEVQCDGRTFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Tissue specificity：Highly expressed in the aorta; weakly found in the kidney, thymus, and intestine. Barely detectable in brain, testis, esophagus, lung, liver, aortic adventitia, vena cava, or uterus; not present in heart and skeletal muscle.
Induction：
Developmental stage：
Protein families：