POPD3_MOUSE   Q9ES81


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ES81

Recommended name:Popeye domain-containing protein 3

EC number:

Alternative names:(Popeye protein 3)

Cleaved into:

GeneID:78977

Gene names  (primary ):Popdc3

Gene names  (synonym ):Pop3

Gene names  (ORF ):

Length:291

Mass:33612

Sequence:MEKNSSLWKSLVTEHPLCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLSSAVWAWVDICAADIFSWNFVLFVICFMQFVHIAYQVHSITFARDFHVLYSSLFKPLGIPLPVFRTIALSSEVVSLEKEHCYAMQGKTSIDRLSVLISGRIRVTVDGEFLHYISPFQFLDSPEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKKHHYDIRLPNYYHMSTPDLSRSPLTEQFRNSRQHCNK

Tissue specificity:Expressed in cardiac and skeletal muscle. {ECO:0000269|PubMed:10882522}.

Induction:

Developmental stage:

Protein families:Popeye family


   💬 WhatsApp