EMC9_HUMAN   Q9Y3B6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y3B6

Recommended name:ER membrane protein complex subunit 9

EC number:

Alternative names:(Protein FAM158A)

Cleaved into:

GeneID:51016

Gene names  (primary ):EMC9

Gene names  (synonym ):C14orf122 FAM158A

Gene names  (ORF ):CGI-112

Length:208

Mass:23061

Sequence:MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA

Tissue specificity:

Induction:

Developmental stage:

Protein families:EMC8/EMC9 family


   💬 WhatsApp