S1A7A_HUMAN   Q86SG5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86SG5

Recommended name:Protein S100-A7A

EC number:

Alternative names:(S100 calcium-binding protein A15) (S100 calcium-binding protein A7-like 1) (S100 calcium-binding protein A7A)

Cleaved into:

GeneID:338324

Gene names  (primary ):S100A7A

Gene names  (synonym ):S100A15 S100A7L1

Gene names  (ORF ):

Length:101

Mass:11305

Sequence:MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Tissue specificity:Overexpressed in psoriasis.

Induction:

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp