H4_MOUSE P62806
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62806
Recommended name：Histone H4
EC number：
Alternative names：
Cleaved into：
GeneID：100041230
Gene names (primary )：H4c1; H4c2; H4c3; H4c4; H4c6; H4c8; H4c9; H4c11; H4c12; Hist1h4m; H4c14; H4f16
Gene names (synonym )：Hist1h4a; H4-53 Hist1h4b; H4-12 Hist1h4c; Hist1h4d; Hist1h4f; Hist1h4h; Hist1h4i; Hist1h4j; Hist1h4k; ; Hist2h4 Hist2h4a; Hist4h4
Gene names (ORF )：; ; ; ; ; ; ; ; ; ; ;
Length：103
Mass：11367
Sequence：MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H4 family