ASCL2_HUMAN   Q99929


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99929

Recommended name:Achaete-scute homolog 2

EC number:

Alternative names:(ASH-2) (hASH2) (Class A basic helix-loop-helix protein 45) (bHLHa45) (Mash2)

Cleaved into:

GeneID:430

Gene names  (primary ):ASCL2

Gene names  (synonym ):BHLHA45 HASH2

Gene names  (ORF ):

Length:193

Mass:20185

Sequence:MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY

Tissue specificity:Expressed specifically in the extravillous trophoblasts of the developing placenta.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp