FXYD5_MOUSE   P97808


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97808

Recommended name:FXYD domain-containing ion transport regulator 5

EC number:

Alternative names:(EF-8) (Ion channel homolog RIC) (Oncoprotein-induced protein 2)

Cleaved into:

GeneID:18301

Gene names  (primary ):Fxyd5

Gene names  (synonym ):Oit2

Gene names  (ORF ):

Length:178

Mass:19454

Sequence:MSLSSRLCLLTIVALILPSRGQTPKKPTSIFTADQTSATTRDNVPDPDQTSPGVQTTPLIWTREEATGSQTAAQTETQQLTKMATSNPVSDPGPHTSSKKGTPAVSRIEPLSPSKNFMPPSYIEHPLDSNENNPFYYDDTTLRKRGLLVAAVLFITGIIILTSGKCRQLSQFCLNRHR

Tissue specificity:Spleen, lung, skeletal muscle, and testis.

Induction:

Developmental stage:Exhibits biphasic expression during development.

Protein families:FXYD family


   💬 WhatsApp