MPZL2_MOUSE O70255
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70255
Recommended name：Myelin protein zero-like protein 2
EC number：
Alternative names：(Epithelial V-like antigen 1)
Cleaved into：
GeneID：
Gene names (primary )：Mpzl2
Gene names (synonym )：Eva Eva1
Gene names (ORF )：
Length：215
Mass：24162
Sequence：MYGKSPALVLPLLLSLQLTALCPTEAVEIYTSGALEAVNGTDVRLKCTFSSFAPVGDALTVTWNFRPRDGGREQFVFYYHMDPFRPMSGRFKDRVVWDGNPERYDVSILLWKLQFDDNGTYTCQVKNPPDVDGLVGTIRLSVVHTVPFSEIYFLAVAIGSACALMIIVVIVVVLFQHFRKKRWADRADKAEGTKSKEEEKLNQGNKVSVFVEDTD
Tissue specificity：Widely expressed (PubMed:9585423, PubMed:29982980). Expressed in the cochlea, in Deiters' cells, possibly at contact sites with the basilar membrane (PubMed:29961571, PubMed:29982980). Expressed in both outer and inner auditory hair cells (PubMed:29961571, PubMed:29982980). In the stria vascularis, detected in the basal cell layer (PubMed:29961571). Not detected in thymocytes, lymphocytes, macrophage or dendritic cells (PubMed:9585423). {ECO:0000269|PubMed:29961571, ECO:0000269|PubMed:29982980, ECO:0000269|PubMed:9585423}.
Induction：
Developmental stage：
Protein families：Myelin P0 protein family