LATH_HUMAN   Q86YQ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86YQ2

Recommended name:Putative BPIFA4P protein

EC number:

Alternative names:(BPI fold containing family A, member 4, pseudogene) (Breast cancer and salivary gland-expressed protein) (Putative latherin)

Cleaved into:

GeneID:

Gene names  (primary ):BPIFA4P

Gene names  (synonym ):BASE LATH

Gene names  (ORF ):

Length:179

Mass:19456

Sequence:MLNVSGLFVLLCGLLVSSSAQEVLAGVSSQLLNDLTQGLLRADFLPSLQTTGLQKPLSSAFDGVSGLLDIFGPPLTNEINTVSIQVKNPQLLHVSIESTPQRKEATVQVPFTSELIVQLLTMKPFTANMQSDIKVQIRLEKNVGGRYELAFGNCRLLPEAIWIQTGVQLAPAQNLLWQT

Tissue specificity:Expressed in breast cancer and salivary gland. {ECO:0000269|PubMed:12538848}.

Induction:

Developmental stage:

Protein families:BPI/LBP/Plunc superfamily, Plunc family


   💬 WhatsApp