FKBP2_HUMAN   P26885


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P26885

Recommended name:Peptidyl-prolyl cis-trans isomerase FKBP2

EC number:EC:5.2.1.8

Alternative names:(PPIase FKBP2) (13 kDa FK506-binding protein) (13 kDa FKBP) (FKBP-13) (FK506-binding protein 2) (FKBP-2) (Immunophilin FKBP13) (Rotamase)

Cleaved into:

GeneID:2286

Gene names  (primary ):FKBP2

Gene names  (synonym ):FKBP13

Gene names  (ORF ):

Length:142

Mass:15649

Sequence:MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Tissue specificity:T-cells and thymus.

Induction:

Developmental stage:

Protein families:FKBP-type PPIase family, FKBP2 subfamily


   💬 WhatsApp