ATP6_MOUSE   P00848


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P00848

Recommended name:ATP synthase subunit a

EC number:

Alternative names:(F-ATPase protein 6)

Cleaved into:

GeneID:17705

Gene names  (primary ):Mtatp6

Gene names  (synonym ):Atp6 Atpase6 mt-Atp6

Gene names  (ORF ):

Length:226

Mass:25096

Sequence:MNENLFASFITPTMMGFPIVVAIIMFPSILFPSSKRLINNRLHSFQHWLVKLIIKQMMLIHTPKGRTWTLMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVITGFRHKLKSSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT

Tissue specificity:

Induction:

Developmental stage:

Protein families:ATPase A chain family


   💬 WhatsApp