ZFP57_HUMAN Q9NU63
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NU63
Recommended name：Zinc finger protein 57 homolog
EC number：
Alternative names：(Zfp-57) (Zinc finger protein 698)
Cleaved into：
GeneID：346171
Gene names (primary )：ZFP57
Gene names (synonym )：C6orf40 ZNF698
Gene names (ORF )：
Length：452
Mass：51919
Sequence：MAAGEPRSLLFFQKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWRETRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK
Tissue specificity：
Induction：
Developmental stage：In contrast to mice, transcripts are undetectable in the oocyte and during the earliest stages of embryonic development, increasing only after zygotic genome activation. {ECO:0000269|PubMed:30602440}.
Protein families：Krueppel C2H2-type zinc-finger protein family, ZFP57 subfamily