BOLL_MOUSE Q924M5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924M5
Recommended name：Protein boule-like
EC number：
Alternative names：
Cleaved into：
GeneID：75388
Gene names (primary )：Boll
Gene names (synonym )：Boule
Gene names (ORF )：
Length：281
Mass：30856
Sequence：MQTDSLSPSPNPVSPVPLNNPTSGPRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPSWPSRSISSSPVMVAQPVYQQPAYHYQAPAQCLPGQWQWGVPQSPASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQAAYHQVYASSAIAMPAPMMQPEPIKVRSLF
Tissue specificity：Testis specific. Not expressed in early embryos, primoridal germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis. {ECO:0000269|PubMed:11390979}.
Induction：
Developmental stage：First expressed in stage III spermatocytes and peaks in late pachytene or diplotene stage spermatocytes. Expressed in secondary spermatocytes and early spermatids, then decreases until it is undetectable in spermatids. {ECO:0000269|PubMed:11390979}.
Protein families：RRM DAZ family