DNJ5G_HUMAN   Q8N7S2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N7S2

Recommended name:DnaJ homolog subfamily C member 5G

EC number:

Alternative names:(Cysteine string protein-gamma) (CSP-gamma)

Cleaved into:

GeneID:285126

Gene names  (primary ):DNAJC5G

Gene names  (synonym ):

Gene names  (ORF ):

Length:189

Mass:21433

Sequence:MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF

Tissue specificity:Testis specific.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp