PROF2_MOUSE   Q9JJV2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJV2

Recommended name:Profilin-2

EC number:

Alternative names:(Profilin II)

Cleaved into:

GeneID:18645

Gene names  (primary ):Pfn2

Gene names  (synonym ):

Gene names  (ORF ):

Length:140

Mass:15032

Sequence:MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Tissue specificity:Isoform IIa is the main isoform and is abundant in brain. Isoform IIb is a minor isoform.

Induction:

Developmental stage:

Protein families:Profilin family


   💬 WhatsApp