UPAR_MOUSE   P35456


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35456

Recommended name:Urokinase plasminogen activator surface receptor

EC number:

Alternative names:(U-PAR) (uPAR) (CD antigen CD87)

Cleaved into:

GeneID:18793

Gene names  (primary ):Plaur

Gene names  (synonym ):

Gene names  (ORF ):

Length:327

Mass:35428

Sequence:MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTGGAPRPGPAQLSLIASLLLTLGLWGVLLWT

Tissue specificity:Expressed in angiogenic endothelial cells (at protein level). {ECO:0000269|PubMed:19667118}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp