M2OM_RAT P97700
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97700
Recommended name：Mitochondrial 2-oxoglutarate/malate carrier protein 2 Publications
EC number：
Alternative names：Solute carrier family 25 member 11 (SLC25A11)
Cleaved into：
GeneID：64201
Gene names (primary )：Slc25a11
Gene names (synonym )：Slc20a4
Gene names (ORF )：
Length：314
Mass：34,244
Sequence：MAATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVXNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGPPAEVALIRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCAIMISGLVTTAASMPVDIVKTRIQNMRMIDEKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG
Tissue specificity：Expressed in liver, heart and brain. 1
Induction：
Developmental stage：
Protein families：