ASIP_MOUSE   Q03288


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q03288

Recommended name:Agouti-signaling protein

EC number:

Alternative names:(ASP) (Agouti coat color protein) (Agouti switch protein)

Cleaved into:

GeneID:50518

Gene names  (primary ):Asip

Gene names  (synonym ):a

Gene names  (ORF ):

Length:131

Mass:14313

Sequence:MDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSLDFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAPACCDPCASCQCRFFGSACTCRVLNPNC

Tissue specificity:Epithelial cells of the hair follicles and the epidermis.

Induction:

Developmental stage:Widely expressed in embryonic and neonatal skin.

Protein families: