CU084_HUMAN P59037
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59037
Recommended name：Putative uncharacterized protein encoded by LINC00313
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：LINC00313
Gene names (synonym )：C21orf84 NCRNA00313
Gene names (ORF )：
Length：77
Mass：8510
Sequence：MTTLSKSKQPSAAGNLDEQTPGECFCRSCFVTSSEVWKRWKHLDPACAADPWEAPTPRIEKPDGKECLGRTSCPRLA
Tissue specificity：Widely expressed; not found in heart and in muscle.
Induction：
Developmental stage：
Protein families：