PSA3_HUMAN P25788
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25788
Recommended name：Proteasome subunit alpha type-3
EC number：
Alternative names：(Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome component C8)
Cleaved into：
GeneID：5684
Gene names (primary )：PSMA3
Gene names (synonym )：HC8 PSC8
Gene names (ORF )：
Length：255
Mass：28433
Sequence：MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
Tissue specificity：
Induction：Down-regulated by antioxidants BO-653 and probucol. Up-regulated by bacterial lipopolysaccharides (LPS) and TNF. {ECO:0000269|PubMed:11521686, ECO:0000269|PubMed:12472671, ECO:0000269|PubMed:16298756}.
Developmental stage：
Protein families：Peptidase T1A family