PHYIP_MOUSE Q8K0S0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K0S0
Recommended name：Phytanoyl-CoA hydroxylase-interacting protein
EC number：
Alternative names：(Phytanoyl-CoA hydroxylase-associated protein 1) (PAHX-AP1) (PAHXAP1)
Cleaved into：
GeneID：105653
Gene names (primary )：Phyhip
Gene names (synonym )：
Gene names (ORF )：
Length：330
Mass：37555
Sequence：MELLSTPHSIEINNITCDSFRISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQHARTHCGNVLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSLGDRFCRDRLPLLDIACNKFLTCSVEDGELIFRHAQDLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR
Tissue specificity：Highly expressed in the brain. {ECO:0000269|PubMed:10686344}.
Induction：
Developmental stage：At 18 dpc, expressed in most tissues, particularly in the skin. By neonatal day 1, the expression in brain and skin is markedly increased, whereas expression in the heart and skeletal muscles shows steady state levels similar to those observed in the fetus. At adulthood, very high expression in brain, little or no expression in other tissues. {ECO:0000269|PubMed:10686344}.
Protein families：PHYHIP family